SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001079 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001079
Domain Number 1 Region: 3-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-65
Family Protein kinases, catalytic subunit 0.0000701
Further Details:      
 
Domain Number 2 Region: 571-659
Classification Level Classification E-value
Superfamily DEATH domain 1.56e-24
Family DEATH domain, DD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001079   Gene: ENSSSCG00000001009   Transcript: ENSSSCT00000001101
Sequence length 664
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:1921742:1945193:1 gene:ENSSSCG00000001009 transcript:ENSSSCT00000001101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDDIKMKSSDFLEKEDLESGGFGKVSLCFHKSHGLVILKKVYTGPKRNEYNESLLEEG
RMMHRLRHSRVVRLLGVVMEEGDYSLVIEYMAKGDLMRVLKAQTPVPLSVKGRIVMETIE
GMRYLHGEGVIHKDLKPENILVDDDFHIKIADLGVASFKTWSKLTKEEHNEQRKVTSTAK
KNGGTLHYMAPEHLNDVNARPSEKSDVYSFAIVLWAIFANKEPYENAICEQQLILCIKSG
NRPSVDDIVEFCPREVVGLMKQCWALSPDDRPTFAGIEEKYRPFYLSQLEGNVEEDVKNL
KKEYPSQNAVVKRMQSLQIDCVAVAPSRSNSAPEQPGSLHSSQGFGMGPVEESWFAPSAE
HQHEENELHLQSKLQEEANYHLFGSRMDRRTKEQPGGSAAYGGEEERRRRVSHDPFAQQR
PHEPAQSPAVKGLACAGPGSAAQHPAGLSSHPQPLYQSHGSHKPQGLGARPLDLGAADRR
VWYMPSQGHRPSLYKTPVPETDLLGNTPTVPFASLPSRDASPRYILYGNSGVQIGDHNYM
ELGGASVSVLDSMCPHVKEEPASKYQAIFENTTSLTDKHLDPVRENLGKNWKICARKLGL
TESQIDEIDHDYERDGLKEKVYQMLQKWLMREGSKGATVGKLARALYQCSRLDLLSCLIR
SSQN
Download sequence
Identical sequences F1RWY6
ENSSSCP00000001079 XP_003128209.1.46622 XP_005665593.1.46622 XP_005665594.1.46622 ENSSSCP00000001079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]