SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001266 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001266
Domain Number 1 Region: 43-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-38
Family SCAN domain 0.0000412
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 426-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001266
Domain Number - Region: 279-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00129
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001266   Gene: ENSSSCG00000001197   Transcript: ENSSSCT00000001295
Sequence length 485
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:23879101:23883002:1 gene:ENSSSCG00000001197 transcript:ENSSSCT00000001295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESTKAASQDLQQDEGLLIVKIEEEDMVWRQDTCLQRSDPLRQELCRRLFRQFCYQDS
AGPREALSRLRELCCQWLKPETHTKEQILELLVLEQFLTILPGDLQAWVREHYPESGEEA
VTILEDLERGTDEAVLQVPVHGHGQEIFRRKVAPPGPGLSVQFEPVDPKTLHGSSEPQLL
LDCDNESENNGSMPKLDIYEKMESQRIISGRISGFVSEGSAEPQDICKSAGRIKRQWEKE
SGESRRPSSAQDGGFSKILTHKNILTGEIISHVGCERSSNLNSNEFTHQKSCKYSTHDQS
FKWNSDFIKHQRICAGEKIHQYGKSLKNPNLTKHAAVFSGEKTHQCNECGKAFRHSSKLI
RHQRIHTGERPYECNECGKGFGGSSDLIRHQRIHTGERPFECKECGRAFSLNSHLILHQR
IHTREKPYECSECGKTFRVSSHLIRHLRIHTGEKPYECSECGRAFSQSSHLSQHQRIHKR
ENLLM
Download sequence
Identical sequences F1RPG2
ENSSSCP00000001266 XP_005665729.1.46622 XP_005665730.1.46622 XP_020955469.1.46622 ENSSSCP00000001266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]