SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001270 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001270
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.16e-36
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 214-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000471
Family KRAB domain (Kruppel-associated box) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001270   Gene: ENSSSCG00000001201   Transcript: ENSSSCT00000001299
Sequence length 309
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:23919648:23934042:1 gene:ENSSSCG00000001201 transcript:ENSSSCT00000001299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEARKSLAPSPPDQAPEEDLVIVKVEEDHGWDQESSLHKNNPPGQELFRLRFRKLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVPARARGRKVLWEEVVHSESAAEPPDTQLQSVATQHKSPVL
QGPQDRAISASQSPTPSQKGSSGDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDPSQ
KDLSRDNRPENYRNMFSLGAETRNENRELASKQVISTGIQPHGETAAKCNGDVIGGLEHG
EARDLLGTL
Download sequence
Identical sequences ENSSSCP00000001270 ENSSSCP00000001270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]