SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001276 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001276
Domain Number 1 Region: 38-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-34
Family SCAN domain 0.0000526
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001276
Domain Number - Region: 214-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000824
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001276   Gene: ENSSSCG00000001207   Transcript: ENSSSCT00000001305
Sequence length 807
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24079744:24099490:1 gene:ENSSSCG00000001207 transcript:ENSSSCT00000001305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEALPGPAPEDGVSLVKVKEEDPAWEQMCSSQESSSHTLELRRLLFRQFCYQEVTRPRE
ALAKLRELCHQWLRPETHTKEQILELLVLEQFLTILPKELQARVQAYPLESGEDAVTVLE
NLEKDTGDSEQQASVYTQGQDMHLLVTEYQGASLECQSPLLLPGVTTLKCEPPELTQEVS
GPAHQGPALLQEENPRDQAAVPELNSARSQTSVKTEEEAAQALVPGEWPHLNLAQRNLHG
NSAREKVTNLSLMTEEVVTKDGLFNPKQETSEEMEPGAEASGIANRDCTPQAPCGISVPV
ERTVVRLNTLKDRHPGDLWARMHVSSLEYAAGDITRKGRKKDKARVSELLQGLAFSGDSD
VEEDNEPETQPASKRLKVSSVPEKNWTKRDIKPNFPSWSALDSGLLNLKSEKLNPVELFE
LFFDDETFNLIVSETNNYASQKNVNLEVTVQEIRCVFGVLLLSGLVRRPQRGMYWEMSDV
DQNLVKDAIRRDRFELIFSYLHFADNSHLDQKDKFTKLRPLIKQMNKNFLLYAPLEEYYC
FDKTMCECFDSDQLLNGKPIKIGYKIWCGTTTQGYLVWFEPYQEELTMMAGKDLDLGLGG
NLVMNFADVLLERGQYPYHLCFDSFFTSVKLMSALKKKGVRATGTIRENRTEKCPLMNAE
HMKKMKKGYFDFRVEENDEIILCRWHGEGVISLCSNAVGIEPVNEICCFADDEEIPEISQ
PSIVKLYDECREGIAKMEQIISKYRVRIRSKKWYSVLVSYMIDVAMSNAWHLHKACNPGA
SLDLGDFQRCVARFYLEHNANISDEGR
Download sequence
Identical sequences F1S1R8
XP_003482189.1.46622 XP_020955452.1.46622 ENSSSCP00000001276 ENSSSCP00000001276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]