SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001452 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001452
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.000000131
Family Ribosomal protein S18 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001452   Gene: ENSSSCG00000001373   Transcript: ENSSSCT00000001494
Sequence length 119
Comment pep:known chromosome:Sscrofa10.2:7:26893404:26894325:1 gene:ENSSSCG00000001373 transcript:ENSSSCT00000001494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPW
YPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL
Download sequence
Identical sequences 9823.ENSSSCP00000001452 ENSSSCP00000001452 ENSSSCP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]