SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001551 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001551
Domain Number 1 Region: 1577-1819
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.65e-54
Family Ankyrin repeat 0.00000123
Further Details:      
 
Domain Number 2 Region: 476-592
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 341-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 925-1049
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000502
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 5 Region: 587-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000821
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 6 Region: 192-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 7 Region: 154-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000544
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 676-801
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000957
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number 9 Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000122
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 235-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000016
Family EGF-type module 0.021
Further Details:      
 
Domain Number 11 Region: 1251-1282
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0024
Further Details:      
 
Domain Number 12 Region: 894-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 839-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000768
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1045-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 15 Region: 807-851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000301
Family EGF-type module 0.018
Further Details:      
 
Domain Number 16 Region: 1214-1244
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 17 Region: 30-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.03
Further Details:      
 
Domain Number 18 Region: 65-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000683
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001551
Domain Number - Region: 117-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1132-1170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000452
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1173-1202
Classification Level Classification E-value
Superfamily Notch domain 0.00536
Family Notch domain 0.0035
Further Details:      
 
Domain Number - Region: 320-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00902
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 625-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0114
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1086-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001551   Gene: ENSSSCG00000001440   Transcript: ENSSSCT00000001593
Sequence length 1994
Comment pep:known chromosome:Sscrofa10.2:7:28052185:28077220:-1 gene:ENSSSCG00000001440 transcript:ENSSSCT00000001593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPSLLLPPLLLLLCRPVVQSRGLQCGSFPGPCANGGTCLSPPQGQGTCQCAPGFLGET
CQFPDPCQDAQLCQNGGSCQALLPTLPGSTSPPSPLTPSFFCTCPFGFTGERCQAQVKDP
CSSFCSKMGRCHIEASGRPRCTCMPGWTGEQCQHRDFCSANPCVNGGVCLATYPQIQCHC
PPGFEGHTCEHDVNECFLNPGPCPKGTSCYNTLGSFQCLCPVGRDGPRCELQPGPCPPRG
CLNGGTCQLVPGRDSTFHLCLCPPGFTGASCEVNPDDCVGHQCQNGGICQDGLGTHTCLC
PEAWTGWDCSEDVDECEAQGVPRCRNGGTCQNSAGSFHCVCVSGWGGTDCEENLDDCAAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHGEAQCSTNPLTGSTLCLCQP
GYTGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFECLCPPGYTGSRCEADHNECLSQ
PCHPGSTCLDLLATFHCLCPPGLEGRLCEVETDECASAPCLNQADCHDLPNGFRCVCQPG
FTGPRCEEDINECRSSPCANGGQCQDQPGSFHCECLPGFEGPRCQTEVDECLSSPCPSGA
SCLDLPGAFLCLCPSGFTGHLCESPLCAPNLCQSKQKCQDQEDKAHCLCPDGSPGCAPAE
DNCTCHHGHCQRSSCVCDVGWTGPECDAELGGCISTPCAHGGTCHPQPFGYNCTCPTGYT
GPTCREEVTACHSAPCLNGGSCSPSPGGYSCTCPPSHTGLHCQTSIDHCASAPCLNGGTC
VNRPGAPSCLCAPGFQGPRCEGRVRPSCADSPCRNRATCQDGPQGPRCLCPPGYTGGSCQ
TLMDFCAQKPCPRNSRCLQTGPSYQCLCLQGWTGPLCNLPLSSCQKAALSQGAEVSSLCQ
NGGICVDNGPSYFCHCSPGFQGSMCQDRVHPCESRPCQHGATCVAQPNGYLCQCAPGYSG
QNCSEEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDRPCHPTGTAA
CHSLANAFYCQCLPGHTGQWCEVEIDPCQSQPCSHGGSCETTAGPPPGYTCHCPQGFEGP
TCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLNGYGGPDCLTPPTPPGCGPPSPCLH
NGSCSETPGLGGPGFRCSCPPSSPGPRCQRPGAKGCEGRGGDGACDAGCSGPGGNWDGGD
CSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPTCTPAYDQYCRDH
FHNGHCEKGCNTAECGWDGGDCRPEDGGSEWGPSLALLVVLSPATLDQQLLALARALSLT
LRVGLWVRKDSDGRDMVYPYPGAQAEEELGGTPDPSHQERAAPQTQPVGKETDSLSTGFV
VVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTAPPA
NQLPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFTRKPRSQAVPRRRRP
PLGEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVGQAEEMASPSKCQLWPLSADCQELP
QAAMLTPPQDSEVDIPDVDTRGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLGG
GACPQVHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREV
CQLLLRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAARADVGARDKWGKTALHWAA
AVNNSRAARSLLQAGADKDAQDGREQTPLFLAAREGAVEVAQLLLGQGAARGLRDQAGLT
PGDIARQRNHWDLLTLLEGAGPPEARHKATPGRGVGTFQRARTASGSVLPRGGGALPRCR
TLSAGACPQARTLSVDLAAHGGGAYSHGRSLSKGGAGGGPPLRGRRFSAGMRGPRPHPAI
VRGRSGVTAGSGGVASGDHWPCDWVALDSCGPASSTPIPPPCLTPSPERASPQVAWGPPA
HQVIPLNAGGEGQK
Download sequence
Identical sequences A5A8X3
9823.ENSSSCP00000001551 ENSSSCP00000001551 ENSSSCP00000001551 NP_001116619.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]