SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001670 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001670
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-85
Family Nuclear receptor ligand-binding domain 0.000000000185
Further Details:      
 
Domain Number 2 Region: 72-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-26
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001670   Gene: ENSSSCG00000001539   Transcript: ENSSSCT00000001714
Sequence length 441
Comment pep:known chromosome:Sscrofa10.2:7:36141606:36215260:-1 gene:ENSSSCG00000001539 transcript:ENSSSCT00000001714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPEEAPEVREEEKKKEVAEAEGGPELNGGPEHSLPSSSCTDLSQSCSPPALLDQLQM
GCDGASCGGLSMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERICKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQHNPQVADLKAFSK
HLYSAYLKNFNMTKKKARAILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFDHLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGTGFVTREFLRSIRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences A9XAM2
9823.ENSSSCP00000001671 ENSSSCP00000001670 ENSSSCP00000001670 NP_001123713.1.46622 NP_999317.2.46622 XP_005665967.1.46622 XP_013833262.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]