SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001718 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000001718
Domain Number - Region: 1-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00113
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001718   Gene: ENSSSCG00000001584   Transcript: ENSSSCT00000001764
Sequence length 109
Comment pep:novel chromosome:Sscrofa10.2:7:38746485:38878917:1 gene:ENSSSCG00000001584 transcript:ENSSSCT00000001764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSITTPTLSSSQQPLPTE
LNVTSPSKEECGPCTDTAHVSLITPTKRSCGTGTYIILIWIHSYLNYSQ
Download sequence
Identical sequences ENSSSCP00000001718 ENSSSCP00000001718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]