SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001818 from Sus scrofa 76_10.2

(show help)
Strong hits

Sequence:	ENSSSCP00000001818
Domain Number 1	Region: 31-78
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000238
Family	LIM domain	0.0016
Further Details:

Domain Number 2	Region: 147-194
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000613
Family	LIM domain	0.0016
Further Details:

Domain Number 3	Region: 113-146
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000555
Family	LIM domain	0.0079
Further Details:

Domain Number 4	Region: 4-30
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000146
Family	LIM domain	0.0094
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSSSCP00000001818 Gene: ENSSSCG00000001672 Transcript: ENSSSCT00000001865
Sequence length	204
Comment	pep:known_by_projection chromosome:Sscrofa10.2:7:43834679:43838041:-1 gene:ENSSSCG00000001672 transcript:ENSSSCT00000001865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSWICPRCLQPVFFAEKVSSLGKNWHRFCLKCEHCHNVLSPGGHAEHNGRPYCHKPCYGV LFGPRGVNIGGVGSYLYRSPAPIPASITPLSPSSFSSPRPRPGLPQGKKSKKTFTGETSL CPGCEEPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHIPCYGYLFGP KGVNIGDVGCYIYDPVEIKSKPQP
Download sequence
Identical sequences	ENSSSCP00000001818 ENSSSCP00000001818

SEARCH