SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001839 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001839
Domain Number 1 Region: 42-294
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-28
Family G proteins 0.002
Further Details:      
 
Domain Number 2 Region: 370-458
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.96e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 280-366
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000052
Family Elongation factors 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001839   Gene: ENSSSCG00000001689   Transcript: ENSSSCT00000001886
Sequence length 472
Comment pep:known chromosome:Sscrofa10.2:7:44294844:44299016:-1 gene:ENSSSCG00000001689 transcript:ENSSSCT00000001886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRVGADITVLREREVDYDSDTPRKITEVLVRKVPDNQQFLDLRVAVLGNVDSGKSTLLGV
LTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYSDSRTAEEICES
SSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAAGTTREHLGLALALKVP
FFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQQFAQSPNVTP
IFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVPEVGTVVGGTL
SSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALGDFDRALLRKG
MVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTG
EKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAIAAGEAQANMAF
Download sequence
Identical sequences ENSSSCP00000001839 ENSSSCP00000001839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]