SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001842 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001842
Domain Number 1 Region: 33-130
Classification Level Classification E-value
Superfamily PDB 1.56e-32
Family PDB 0.001
Further Details:      
 
Domain Number 2 Region: 61-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.1e-21
Family Ribosomal protein S18 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001842   Gene: ENSSSCG00000001692   Transcript: ENSSSCT00000001889
Sequence length 196
Comment pep:novel chromosome:Sscrofa10.2:7:44224282:44370509:-1 gene:ENSSSCG00000001692 transcript:ENSSSCT00000001889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVEILDGKTTIIEGRITETPQES
PNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVK
MAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPL
LKDNVSYSGRPLLLYH
Download sequence
Identical sequences F1RRH6
XP_005654252.2.46622 4v1a_x 5aj4_Bx 6gaw_Bx 6gb2_Bx ENSSSCP00000001842 ENSSSCP00000001842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]