SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001859 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001859
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.37e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000311
Further Details:      
 
Domain Number 2 Region: 285-487
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.88e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00018
Further Details:      
 
Domain Number 3 Region: 620-798
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.01e-32
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 531-620
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000244
Family AlaX-M N-terminal domain-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001859   Gene: ENSSSCG00000001706   Transcript: ENSSSCT00000001906
Sequence length 985
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:45170562:45183626:-1 gene:ENSSSCG00000001706 transcript:ENSSSCT00000001906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAAAGRIRRAIRRSPPWQGLCFRALSSEAPPTQAAAVRDAFLSFFRDRHGHRLVP
SASVRPRGDPTLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLED
VGQDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFGGDPKAGL
GADLESRDIWLNLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLNAIHQGC
GAPPYSGRVGAADEGHIDTAYRVVADHIRTLSICIADGVSPGMSGAPLIVRRILRRAVRF
STEVLRAPPGFLGSLVPVVVETLGGAYPELHKNSAQIVSLVSEDEAAFLASLQRGRRIIE
RTLKRLGPSDVFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVQLDSAGLARLAQEEAQHR
AQQAEPVQEQGLRLDVHALGELQRRGVPPTDDSPKYSYSLRPSGGYEFSTCEARVLQLYA
EDGRAVATTGEGQRYGLLLDRTNFYAEQGGQASDRGYLVRVEQQDVLFPVAQAQVCGGFI
LHEVVAPECLKVGDRVQLHVDEAWRLSCMEKHTAAHLLNWALRKALGPSTEQRGSHLSPE
RLRFDVATQAPLTPKQLQAVEDTVQEAVGRDEAVYMEEVALARTTHVPGLRSLDEVYPDP
VRVVSVGVPVAHALEPASQAALQTSVELCCGTHLLRTGAIGDLVIVGERQLAKGTTRLLA
ITGEQARQAREVGQSLAQEVEAAAERLSRGSRDVVEAQRLSKDMGRLTDAVDTSVMPQWQ
RRELQATLKALQRRANTAIRKLEMGQAVLKTQELLQRHSEGPLIVDTVSAESLSMLVKVV
RQLCKQAPSTSVLLLSPQPLGQVLCACQVAQSATPAFTAEAWALAVCSHMGGKAWGSRVV
AQGTGSTADLEAALSAARAYALNQL
Download sequence
Identical sequences 9823.ENSSSCP00000001859 ENSSSCP00000001859 ENSSSCP00000001859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]