SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001961 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001961
Domain Number 1 Region: 31-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000288
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001961   Gene: ENSSSCG00000001794   Transcript: ENSSSCT00000002010
Sequence length 201
Comment pep:novel chromosome:Sscrofa10.2:7:56738471:56787509:1 gene:ENSSSCG00000001794 transcript:ENSSSCT00000002010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LECLRYKPGPCYFIVFTIQTSRNTRSDEDKDSNWDAWGDWSDCSRTCGGGASYSLRRCLT
GRNCEGQNIRYKTCSNHDCPPDAEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPTAPCALK
CHAKGQNLVVELAPKVLDGTRCNTDSLDMCISGICQAVGCDRQLGSHAKEDNCGVCAGDG
ATCRLVRGQSKSNVSPEKKKN
Download sequence
Identical sequences ENSSSCP00000001961 ENSSSCP00000001961 9823.ENSSSCP00000001961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]