SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000002057

Domain assignment for ENSSSCP00000002057 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000002057
Domain Number 1	Region: 2-130
Classification Level	Classification	E-value
Superfamily	N-terminal domain of MutM-like DNA repair proteins	1.18e-29
Family	N-terminal domain of MutM-like DNA repair proteins	0.000000441
Further Details:

Domain Number 2	Region: 133-244
Classification Level	Classification	E-value
Superfamily	S13-like H2TH domain	2.8e-27
Family	Middle domain of MutM-like DNA repair proteins	0.00000217
Further Details:

Domain Number 3	Region: 248-290
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	1.35e-18
Family	C-terminal, Zn-finger domain of MutM-like DNA repair proteins	0.00011
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000002057 Gene: ENSSSCG00000001882 Transcript: ENSSSCT00000002107
Sequence length	389
Comment	pep:known_by_projection chromosome:Sscrofa10.2:7:62949965:62956276:-1 gene:ENSSSCG00000001882 transcript:ENSSSCT00000002107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPEGPELHLASHFVNEACGELVFGGCVEKSPVSRNPEVPFESSAYHISALARGKELRLTL SPLPGAQPPQEPLALVFRFGMTGSFQLVPRDALPPHAHLRFYTAPPSPQLALCFVDIRRF GRWELGGEWDPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA EILHRLRIPPFEKARTVLEALQRHRLSPELTLSQKIKAKLQNPDLLELCHSVPKEVVQLG GKGYGPESREEDFAAFRAWLRCYGTPGMNSLRDRHGRTIWFQGDPGPLAPKGGKSRKKKS KGAQQGPEDRVEDPTLQNKATLRTRRTQRGLEQSTAQQPKGTSLQQDPETPLVPEKGKRR RRQATSGRRRPQKITGDTPSLEPEGTSAS
Download sequence
Identical sequences	F1SJ67 ENSSSCP00000002057 9823.ENSSSCP00000002057 XP_001924578.1.46622 XP_005666203.1.46622 XP_013833516.1.46622 XP_013833518.1.46622 XP_020954687.1.46622 XP_020954688.1.46622 XP_020954689.1.46622 XP_020954690.1.46622 ENSSSCP00000002057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]