SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002084 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000002084
Domain Number - Region: 16-26,129-135
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00418
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002084   Gene: ENSSSCG00000001905   Transcript: ENSSSCT00000002134
Sequence length 200
Comment pep:novel chromosome:Sscrofa10.2:7:63774840:63775439:1 gene:ENSSSCG00000001905 transcript:ENSSSCT00000002134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLQPQQKQQQQQQPPPPPPPPPQPPHLAPLQMDAREKQGQQMREAPFLYAQKLVTQQT
HLSATPGRSSGSPALGPLARVPPAVARVFERSKVNSEPEEEEGGLEDEDGDDEVAEVAEK
EAQTASKYFHVQKVTRQDPRAAPVSGLLPAPGLPPHGQQAKEDHTKDASKASASVSTTGQ
PGWNLDEQLKQVSLSGVGGY
Download sequence
Identical sequences ENSSSCP00000002084 ENSSSCP00000002084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]