SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002875 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002875
Domain Number 1 Region: 63-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 2.04e-34
Family PSF2 C-terminal domain-like 0.00000169
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 1.01e-21
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002875   Gene: ENSSSCG00000002663   Transcript: ENSSSCT00000002954
Sequence length 185
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:3528008:3551972:1 gene:ENSSSCG00000002663 transcript:ENSSSCT00000002954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVQVPLWLAINLKQRQKCRL
LAPEWMDVEKLEKMRDHERKEDTFTPAPNPHYTELTKLLLNHASDNIPKADEIRTLIKDV
WDTRVAKLRVSADSFVRQQEAHAKLDNLTLMEVNAGGAFLTRALSHMFKLRTNLQPADSA
PTQDL
Download sequence
Identical sequences A0A287A814
ENSSSCP00000002875 ENSSSCP00000002875 9823.ENSSSCP00000002875 XP_003126865.1.46622 XP_020949375.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]