SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002881 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002881
Domain Number 1 Region: 26-215
Classification Level Classification E-value
Superfamily PR-1-like 2.88e-55
Family PR-1-like 0.0000979
Further Details:      
 
Domain Number 2 Region: 284-381
Classification Level Classification E-value
Superfamily LCCL domain 3.66e-29
Family LCCL domain 0.00088
Further Details:      
 
Domain Number 3 Region: 385-487
Classification Level Classification E-value
Superfamily LCCL domain 3.66e-27
Family LCCL domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002881   Gene: ENSSSCG00000002669   Transcript: ENSSSCT00000002960
Sequence length 495
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:4412902:4460433:1 gene:ENSSSCG00000002669 transcript:ENSSSCT00000002960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCVLHGIPALGLALLVCGAQGFFLPNVTHLEKLLSKYQQDRPHSRARRAIPRVDQEEIL
MLHNKLRGQVSPPASNMEHMTWDEELARSAAAWAQECIWEHGPTSLLVSIGQNLAVHWGR
YRSPGFHVQSWYDEVKDYTYPYPHECNPWCPERCSGAMCTHYTQIVWATTTKIGCAVNTC
RRMNVWGDVWENAVYLVCNYSPKGNWIGEAPYKTGRPCSQCPPSYGGGCRNNLCYRGWVE
ARPPEPCEATGHLACRLPLAHPTPAATAEQFQNIPESSSKQTVAQVIKCDTKMKDKCKGS
TCNRYQCPAGCLHNRAKIFGTLFYESASSICRAAIHYGILDDKGGLVDVTRNGKVPFFVK
SERNGVQSLSKYKASSSFTVSKVKVQDLDCYTTVAQLCPFEKSGTHCPRVRCPAYCKDEP
SYWAPVFGSNIYADTSSICKTAVHAGVIKNDSGGYVDVMPVDKKKTYVGSLRNGVQSESL
GSRPGSLYGSVLGVG
Download sequence
Identical sequences ENSSSCP00000002881 ENSSSCP00000002881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]