SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002938 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002938
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.22e-62
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000153
Further Details:      
 
Domain Number 3 Region: 597-739
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-32
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 5.89e-16
Family AlaX-M N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002938   Gene: ENSSSCG00000002723   Transcript: ENSSSCT00000003017
Sequence length 954
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:13363477:13385173:-1 gene:ENSSSCG00000002723 transcript:ENSSSCT00000003017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDSKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGADDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRERGLEA
TDDSPKYNYHSDSSGSYVFESAVATVMALRRDRMFVEEVCTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGSLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQRGSLVAPDRLRFDFTAKGAMSTQQIKKAEELANEMI
EAAKPVYAQNCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLQNSSHAGAFVMEESLLWCVYVSSLSGRGWAALVFKAGGVGWAHVLGVRVPVV
FLFWFQALATAVIPQWQKDEFRENLRSLKKVMDDLDRASKADVQKRVLERTKQLIDSNPN
QPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKIICLCQVPQNIANRGL
KASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLRLEDVKN
Download sequence
Identical sequences ENSSSCP00000002938 ENSSSCP00000002938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]