SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002939 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002939
Domain Number 1 Region: 43-243
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-44
Family FAD-linked reductases, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002939   Gene: ENSSSCG00000002724   Transcript: ENSSSCT00000003018
Sequence length 294
Comment pep:novel chromosome:Sscrofa10.2:6:13389858:13409189:1 gene:ENSSSCG00000002724 transcript:ENSSSCT00000003018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMFYRLLSVVRRRGSSRGWQKWSSARSSASAAEVHSVALPAEAQVVICGGGIMGTSVAYH
LSKMGWKDVVLLEQGRLAAGSTRFCAGILSTARHLSIEQKMADYSNKLYHQLEQETGIQT
GYIRTGSIFLAQTQDRLISLKRINSRLNVIGIPSEIVSPKRVAELHPLLNVHDLVGAMHV
PEDAVVSSADVALALASAASQNGVQIYDRTSILHVMVKKGQVTGVETDKGQIQCQYFVNC
AGQVELSVVVPFILPPSREVLGCSIVLGTWTEFPLKADWSIASHSVVLRGSRSI
Download sequence
Identical sequences ENSSSCP00000002939 ENSSSCP00000002939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]