SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003094 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003094
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 2.47e-218
Family Phosphoglucose isomerase, PGI 0.00000000000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003094   Gene: ENSSSCG00000002873   Transcript: ENSSSCT00000003175
Sequence length 558
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:39517086:39547942:-1 gene:ENSSSCG00000002873 transcript:ENSSSCT00000003175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTQNPQFKKLQTWYHEHRSDLNLRRLFEGDKDRFNHFSLNLNTNHGRILLDYSKNLV
TEAVMQMLVDLAKSRGVEAARERMFNGEKINFTEDRAVLHVALRNRSNTPILVDGKDVMP
EVNRVLEKMKSFCKRVRSGEWKGYSGKSITDVINIGIGGSDLGPLMVTEALKPYSAEGPR
VWFVSNIDGTHIAKTLATLNPESSLFIIASKTFTTQETITNAETAKEWFLQSAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINFFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRAHLAWAGVPLGSRDSSVRSAFSRRPEGGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTEEARKELQAAGKSPEDFEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIAMYEHKIFVQGVIWDINSFDQWGVELGKQLAKKIEPELDGSSPVTSHDS
STNGLINFIKQEREARSQ
Download sequence
Identical sequences ENSSSCP00000003094 ENSSSCP00000003094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]