SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003226 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003226
Domain Number 1 Region: 27-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-23
Family Spermadhesin, CUB domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003226   Gene: ENSSSCG00000021947   Transcript: ENSSSCT00000003308
Sequence length 132
Comment pep:known chromosome:Sscrofa10.2:6:43695821:43701169:-1 gene:ENSSSCG00000021947 transcript:ENSSSCT00000003308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGSAIPWALLLSTATLVSTAQNKGPHKCGGVLRDLSGRISTYEGPKTDCIWTILAKPG
SRVFVAIPYLNLACGKEYVEVQDGLPGAGNYGKLCSGIGLTYQSSSNALSIKYSRTAGHS
ASSFDIYYYGDS
Download sequence
Identical sequences Q4R0H3
NP_001020381.1.46622 XP_005655871.1.46622 ENSSSCP00000003226 ENSSSCP00000003226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]