SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003309 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003309
Domain Number 1 Region: 15-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.03e-64
Family N-terminal domain of xrcc1 0.0000000931
Further Details:      
 
Domain Number 2 Region: 558-648
Classification Level Classification E-value
Superfamily BRCT domain 3.66e-22
Family DNA-repair protein XRCC1 0.00000834
Further Details:      
 
Domain Number 3 Region: 338-422
Classification Level Classification E-value
Superfamily BRCT domain 2.62e-20
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003309   Gene: ENSSSCG00000003055   Transcript: ENSSSCT00000003392
Sequence length 652
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:46158727:46180753:-1 gene:ENSSSCG00000003055 transcript:ENSSSCT00000003392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPASFWPGEAHGADMPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVV
LQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPN
RVRIFGPDKLVRAAAEKRWDRVKIVCSQPYSKDAPYGLSFIRFHSPPDKDEAEASSQKVT
RLGQFRVKEEDESTSSLRPGALFFSRINRTPPVAASDPAGPSYAAATLQASSAASSVSPA
SKATGSASRAAGSTSKPQESPKGKRKLDLNQEAKKTPSKPSAQPSPPALKRPKLPAAPRT
PATAPLPAPARGAAPGKPRGEGAKPRAPRAGPQELGKILQGVVVVLSGFQNPFRSELRDK
ALELGAKYRPDWTPDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRY
LMAGPDSSSEDEGGSPGGSSGDEAPKPPRQRPQTKARPPQAAGPSLPQRPPAPEETKPAS
PRPQDDTDIEGEQSAGQDNGAEDSGDTEDELRRVAEQKEQRQPPGQGENGEDPYAGSTDE
NTDNEGPPESPDLPVPELPDFFQGKHFFLYGEFPGDERRRLSRYVTAFNGELEDYMSDRV
QFVITAQEWDPSFEEALMDNPSLVFVRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences 9823.ENSSSCP00000003309 ENSSSCP00000003309 ENSSSCP00000003309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]