SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003483 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003483
Domain Number 1 Region: 217-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-70
Family Nuclear receptor ligand-binding domain 0.000000000494
Further Details:      
 
Domain Number 2 Region: 84-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-26
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003483   Gene: ENSSSCG00000003211   Transcript: ENSSSCT00000003566
Sequence length 458
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:51087295:51094351:1 gene:ENSSSCG00000003211 transcript:ENSSSCT00000003566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTTSSLDTPLPGGNGPLQPSTLSSSSDGKEDGPEPLPGGADPDVPSTDGAGSASVVV
ILDPAEEPERKRKKGPAPKMLGDELCQVCGDTASGFHYNVLSCEGCKGFFRRSVIRGGAG
RYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSKEQIRKKKIRKQQQQQQQQS
SPTAPGVSSGSASGPGASPGGSDGGGQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSF
SDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIAL
LKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMRRL
GLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVDALLSYTRIKRPQDQLRFPRMLM
KLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences A0A287BPN6
ENSSSCP00000003483 ENSSSCP00000003483 XP_005664839.1.46622 XP_013854146.1.46622 XP_020950450.1.46622 9823.ENSSSCP00000003483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]