SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003558 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003558
Domain Number 1 Region: 581-1018
Classification Level Classification E-value
Superfamily RNI-like 5.1e-75
Family 28-residue LRR 0.0000278
Further Details:      
 
Domain Number 2 Region: 163-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000732
Family Nucleotide and nucleoside kinases 0.088
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily DEATH domain 0.00000113
Family Pyrin domain, PYD 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003558   Gene: ENSSSCG00000003279   Transcript: ENSSSCT00000003643
Sequence length 1049
Comment pep:novel chromosome:Sscrofa10.2:6:54156647:54182781:1 gene:ENSSSCG00000003279 transcript:ENSSSCT00000003643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSAQLHFHLQPLLEQLDQQELSKFKSLPKALSLQEELQHVPQMALDKASGRILSEPLF
SCSLSKRNSRLAVFRSLNASWLIHLASHQLLRSGELTKIQEEDVAHPGEAKEGLEGEKLG
EQEKYRNALKKKSWQIWQNSRPGASEHVHIFTRRYEALVPFCNPQVPTGPFPHTVVLHGP
AGVGKTTVAKKLMLDWTQDGLAQAVHSAFYLSCKDLSHRGTCTFAELIAAAQPGAREAVP
QLPARAQEILLVVDGFEELRVPSGALVRDLCGDWKQPKPVAVLLGSLLRRKMLPRATLVI
TTRPGALRELRLLAEQPLFVEIEGFLEPDKKAYFLEHFGEERQALRAFALMKGNAALFRL
GSAPAVCRIVCTCLKAQMEGGEDPASTCQTTTSLFLRFLCSQFAPAPGACPHPRLQAALR
AACLLAAEGAWTQTSVFDGDDLGRLGLTPSALCPFLDKQILQKNGDCGGCYSFVHLSVQQ
LLAAMVYVLETEEEEAAAGGEAGGCTWDIGDVQKLLSKEERRKNPDLTRVGSFLFGLLNE
ERARELETTFGCRVSGAVRRELLKCRSESDGNGPFSSMMDTKEMLHCLHESQEEQLVKDA
MAHVPEIAVHLTSAFEMVEASFCLKHCQDLRKISLQVGKRIFLENDADAEVDREFSSCLF
LKNCALSQHDQHSLQVWADLCSVFSSNENLLFLDVRDSVLSRSSVRILCEQVTHATCHLQ
KVVIKNISPADAYRDFCLAFIGKKTLTHLVLEGNVHSDKMLLLLLCEILKHARCNLQYLR
LGSCSDTTQRWADFSSALKINQSLKCLDLTASEFLDEGVKLLCATLRHPKCSLQKLSLED
CQLTEACCKELSSALIVNQRLTHLCLAKNNLGDHGVKLLCEGLSYPECQLQTLVLRHCSI
NRHGCKYISKLLQGDCSLTSLDVGFNPITTGLYFLCEALKKPNCKLKCLGLWGCSITPFS
CQDLASALLSNQSLETLDLGQNILGQSGVTALLEALKQKHGPLKTLRLKADESTKIQRMA
EAVREGNPQLTVEWNHTGTRRSLCCDFLS
Download sequence
Identical sequences ENSSSCP00000003558 ENSSSCP00000003558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]