SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003593 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003593
Domain Number 1 Region: 535-942
Classification Level Classification E-value
Superfamily RNI-like 7.85e-68
Family 28-residue LRR 0.0000345
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily DEATH domain 4.47e-16
Family Pyrin domain, PYD 0.039
Further Details:      
 
Domain Number 3 Region: 142-312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000072
Family Nucleotide and nucleoside kinases 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003593   Gene: ENSSSCG00000003314   Transcript: ENSSSCT00000003678
Sequence length 943
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:55279672:55336909:-1 gene:ENSSSCG00000003314 transcript:ENSSSCT00000003678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETDSPDFDLLWYLEKLNKKEFMSLKNHLKQECLEIGLPEIPGTAKPDLGNLLTTFYEA
QHVWNMMLSIFKKIRRADLCEKIKARRKRNRETHKALIKNKILLQWEKCLFENVHNTFYE
ETIVEVLRKLDTVYDPRSTFYTKDVFLVGEKGAGKTMVMKVVLLQWTHGDIWKDVISYIV
HLTSHEINQMSESSLVELISKEWPSGQAPVADILSDSQKLLFILEDMDNVDASLNVDESA
LCSDSRKHVPVSVLLSSLFKRKMAPGSLFLISLRPDGKAAVTASMKKNYCITLKFSDEKR
KKYFALFFKDSQKAARALKLVQENDMFVNLCQVPVSCWITCVALNRQVEMGGEGKLSCQT
LTDLYAHFLANTLTSGAGMTTSQRRRTLLERLCLLALEGLWHDTLHFTDGDLRSVGLTKA
DVSALKALRILLPSSNCTDHHTFVHLKIQEFCAAVGYMMLLSECQIPSANKKYPERRERY
NDFSPITTSIFGLLNEKRRKILETSIGCNLLTGELKKYFLQKMKYVGDHPKTVEHHTPLF
YCLFENQDEEFVKQIMDSFLEVTIYIQENKDLMVSLYCLEHCRLLQKLKLSVQCIFENKE
PHMLTPSSKMRSLVYWRDLCNLLHTKENLKELEICNSDFDDTSERVLCKALTHGSCHLQT
LKLSYLSVGTRFEDVFRAIVYNPNLKFLSLNCVPHSLKMFSLLGEVLENPVCRIQHLSLM
KCDLKASECQEIASLLIKSKNLKKLTLSNNPLKNEGVKILCNALLHPDCTLESLVLESCG
LTSEVCHQLFMELGKNTSLNFLSLGDNSLCDVEIKRLQGPLGTSKCPLKELSLEKCSLPV
ASCRDLALLLISTHRMTRLCLGFNQIQDAGVKLLCASLAHPKCLLERLVLWFCQLSAASC
RYLSNALLQNKRLTHLNLRKNNLGDEGVKFLCEPLRCPDCNLQ
Download sequence
Identical sequences ENSSSCP00000003593 ENSSSCP00000003593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]