SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003594 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003594
Domain Number 1 Region: 604-1012
Classification Level Classification E-value
Superfamily RNI-like 1.96e-67
Family 28-residue LRR 0.0000557
Further Details:      
 
Domain Number 2 Region: 30-118
Classification Level Classification E-value
Superfamily DEATH domain 2e-24
Family Pyrin domain, PYD 0.0077
Further Details:      
 
Domain Number 3 Region: 194-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000422
Family Nucleotide and nucleoside kinases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003594   Gene: ENSSSCG00000003315   Transcript: ENSSSCT00000003679
Sequence length 1015
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:55500384:55520014:1 gene:ENSSSCG00000003315 transcript:ENSSSCT00000003679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSCSSSSPSPSPFSTSSPFFSPSSSSTFPFKNGVMLYLIYLSKENLQRFKQLLLEEIPR
PGSIPITWDQVQMARWAEVAHLLTECFPGRLAWDVTHDIFSKMNQTELCLRVQMELNDIL
PNLKPETLKPRDMQVNLEEDESGKIQEYKRRVMDEYSTLLDRTTWPGNHTDFFYQDVCRE
ETFLPCLLLPRRPQGRQPKTVVLRGVAGIGKTSQAKMVMSAWAKNRFYPHKLWFAFYIHC
QDSDQVDEQSFCELIARKLSGTQALASKILSKPDQLLLLLDGFEDLTWTLTDRPEDLSED
WNRKLPWSVLLTSLLSKRMLPEATLLIFLRFPFWKNVSPFLKCPSVITLTGFSVPERTRY
FRTYFGNENEAEEALGFVMGNTILFSMCQVPVICWLVCYCLKQQMGRGANLPQTYPNATA
VFVHYLSGLFPTKAKHLSQKTHQEQLKGLCSLAAEGMWERRWVFNKTHLKLARLDETDVA
TFLSLSIFRRVAGKEDLYAFTLLTFQEFFAALLYVLCFPKRLRNFHALDQFYILRLIAHP
RRKRNHLAQMALFLFGLFNETCTLAVEQRFGCKVSWGNKKKLLKTASLPHESDPPTLHHG
VPQLFNCLHEIQEEAFVSQTLSDCRRAVLVVNRNKDMQVSAFCLKRCRRLQALELTVNLI
VTKAGQFYTDSPPCSDAPRSEGHERSSLWWQDFCSIFKTLENLEVLAVTHSTVDADSLMV
LSSALTHPHCKLQKLIFRHVSPLMLNEDLIRVLVENQHLRSLEIQATEVRCQVMEFLCHT
LKHPRCFLQCLRLEDCPFSPKNWADLARNLKSNIHLKTLMLRRSSLEKGEPCHHLAVAQL
ERLALENCDLTLLSCKSLIYSLESNKNLTHLSLAKNSLKDDGAKQLWDALQHTRHPLQRL
VLRNCALTSDCCQNMASALNKNKTLRSLDLGFNSLKDDGVIMLCQPLMDPDSGLQVLELE
NCLFTSSCCEAMASVLLSNQSLRYLDLSKNDIQCHGVRFLCETIQKKKGKVKVIL
Download sequence
Identical sequences ENSSSCP00000003594 ENSSSCP00000003594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]