SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003600 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003600
Domain Number 1 Region: 281-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-21
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 245-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.17e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0000000549
Family SCAN domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003600   Gene: ENSSSCG00000003320   Transcript: ENSSSCT00000003685
Sequence length 381
Comment pep:novel chromosome:Sscrofa10.2:6:55712170:55839156:-1 gene:ENSSSCG00000003320 transcript:ENSSSCT00000003685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMDRLVLEQFMICMPLECQVLVKESGVESCQELEDMLINQQKPKKWTVVCIRGQDFLVPV
LESEILEVEVSDMDDERNVPEKPQSTVRKIHAGHGHQEGQELQNLPRVKDLSRGQDKKGF
LPATIPDPRVREGRTPKENMEQDLVEDKEDTRTPTQSQEPELRKGPETEEPTAGGNRGES
VRRLTRSKRRRASSLTSQEGLQEGAPSLDTGRCSGQPQTSSACSAGRVKTTSHAKGKEAP
GGTDYQCRECNKRFHYRSQFTLHKRTHTGERPFQCSLCAKAFMQPSDLRVHQRIHTGEKP
YRCDTCSRDFTHDSTLRAHKRTHTKERPFPCEQCDMAFSHRGNLNVHRRTHSGLKPYVCP
ECHGAFRQLGTFKRHQKTHLK
Download sequence
Identical sequences ENSSSCP00000003600 ENSSSCP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]