SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003601 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003601
Domain Number 1 Region: 35-116
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.01e-28
Family SCAN domain 0.00049
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-21
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 355-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003601   Gene: ENSSSCG00000003321   Transcript: ENSSSCT00000003686
Sequence length 495
Comment pep:novel chromosome:Sscrofa10.2:6:55845854:55849680:-1 gene:ENSSSCG00000003321 transcript:ENSSSCT00000003686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFTNWKLGGDPFLGPESKPPGPVPRQGTLAEKPDSESETWHVRFRTFISSKESNPIQDLR
RLRELCHLWLRPDLHTKEQIMDRLVLEQFMICMPLECQVLVKESGVESCQELEDMLINQQ
KPKNCTIVHVGGQDFLVRGSDVDTVEAEARDMDDERALCKEPLSSVSEIHAENGQQESQE
LQNFPDVQEPARGQDKKGFLPATIPDPRVREGRTPKENMEQDLVEDKEDTRTPTQSQEPE
LRKGPAAGWTEGGKNPEEGASVTHGDADLPCTSSVPETEEPTAGGNRGESVRRLTRSKRR
RASSLTSQEGLQEGAPSLDTGRCSGQPQTSSACSAGRVKTTSHAKGKEAPGGTDYQCREC
NKRFHYRSQFTLHKRTHTGERPFQCSLCAKAFMQPSDLRVHQRIHTGEKPYRCDTCSRDF
THDSTLRAHKRTHTKERPFPCEQCDMAFSHRGNLNVHRRTHSGLKPYVCPECHGAFRQLG
TFKRHQKTHLKRPHQ
Download sequence
Identical sequences ENSSSCP00000003601 ENSSSCP00000003601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]