SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003607 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003607
Domain Number 1 Region: 1185-1206,1236-1263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000323
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 2 Region: 447-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000487
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 1067-1090,1119-1146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000256
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 28-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00000000156
Family SCAN domain 0.00084
Further Details:      
 
Domain Number 5 Region: 1452-1475,1505-1532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000907
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 936-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000891
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 550-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000097
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 8 Region: 606-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000474
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 9 Region: 1290-1318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000512
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003607
Domain Number - Region: 1007-1043
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00482
Family Classic zinc finger, C2H2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003607   Gene: ENSSSCG00000003326   Transcript: ENSSSCT00000003692
Sequence length 1534
Comment pep:known chromosome:Sscrofa10.2:6:56621615:56629815:-1 gene:ENSSSCG00000003326 transcript:ENSSSCT00000003692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLAPDLYELDGDVSREPDAIVGDSATDSEFFHQRFWNFLYVEFVGPWKTPLTRNLCLDW
LQPGPRAEEEIIALSVLEQLTVLPEPVEPRAPARRPGDCEALVSLREWHAEMYEPEDDSS
SDSHSESSMSRRAAESPPRSAHSFSRDRDWERDGERNQDHRRGRSRDLEARDRWPYARTP
RSRFPQRDLSLPLMERKAFAKGREHKHRDSAVGYEARSQDTVSYQDMGDLAEDRKLQNPI
QDNMENYRKLLSLGTGVQLAEDDGHSHMTQGHSSRSRRSAYPSTSRGLKTLPETKKPAHR
RGICEDESSHGVIMEKFIKDVARSSRSGRAREPSDRPQRLPRRPDGGWKEVSVSKREAVI
QERACEGGALGGGGFPCNASLVSKKRVLERKRRYPFDADGKGSVHDQRGCARKRPFECGE
VRKAASVSSLSAPPLPGSPPLVLGAMPYVCDECGRSFGVISEFVEHQIMHTRESLYEYGE
SFIHSVAISEVQRSQAGGKRFECKECGETFNRSAALAEHRKTHARENLAEGQAEVCEEPF
LPSPTFSELQKIYGKEKFYECKVCKETFLHSSALVDHQKTHGREARAGERADAFQPSPAP
KELPRLYGREKLYECRVCGETFHHSAALREHQQVHARGHPPESRGRACEETMPGQSLRRR
QKTYPKEKLYDFAAAGEAFQGSRLLEPQKIRSRRELFEGRGYHKSAVHGVSFPESQKSHT
IPRPENEEDERAFTVSCSPASSREAAAGERSVLRSSAFAAAQRSHSAAGPSRPRGFAEST
VHSSGVISRRQVPAGESSLERRRLESSVIHSLAALKPPRGRGGRELLGGGEKGAPSTYLA
GLREQQRAPAREGPHEGGAEDISQGSGARSASQAEAQPSGEGPSGVKTAGEASVPGSGVR
EHQKARAKKKNIEHRNYDASVTHSLRFGQPLTFRPREKFYECPECGESFARSSDLTEHQK
IHDRKKPSGGKNYIRSVIRSLASADPQTSYAGWAAQTRFAEPPVRSECKECGEYFATLED
LGAHQKIYAREKLHVGKLFGGSVVQSAGGAGPQQDELDELDEAEDSIYGCKDCGLGFADR
ADLRDHQKVHGREYLIDSREYTHSVVHTHSVSEYQKDYTGEQLYECPACGESFVHSSFLF
EHQKVHEQDQFYGQRRYEEPFLQPLVISPRGPRAPQKSPAGTSLLCQVCGRDFIHGSVLS
EHMRVHAGEDLPEQGGRAEAAGGPSAAPAAPPRDEAEEKRYACETCGESFRSQADLREHM
RTHEKEEPYDYGATFVHTSFLTEPPKRDSPFYECKDCGKSFIHNTVLTKHQKLHLEEEEA
AAAAAQEVEANVLVPREVLRIQGSNVEAAEPEVEAAEPEVEAAEPNVEAAEPNGEAEGPE
GEAAEPNGEAEQPNAEAEQPNGDADEPDGAGIEDPEERAEEPEADADEPDGLGVEDPEEE
GEDQEIQVEAPYYGCGECAETFTSSSANGEHLKSHARVMTFEPGSVCGENSHPTEHASTS
GSGRADDKYFKCDVCGQVFSDRLSLARHQNTHTG
Download sequence
Identical sequences ENSSSCP00000003607 ENSSSCP00000003607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]