SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003665 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003665
Domain Number 1 Region: 329-412
Classification Level Classification E-value
Superfamily DEATH domain 1.01e-19
Family DEATH domain, DD 0.0013
Further Details:      
 
Domain Number 2 Region: 36-92
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000283
Family TNF receptor-like 0.0034
Further Details:      
 
Domain Number 3 Region: 95-145
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000406
Family TNF receptor-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003665   Gene: ENSSSCG00000030805   Transcript: ENSSSCT00000003751
Sequence length 415
Comment pep:novel chromosome:Sscrofa10.2:6:62452678:62457232:-1 gene:ENSSSCG00000030805 transcript:ENSSSCT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRPGPCAVVVAVALLLLLPGARGQGSTPSAHCDCVPNQKRNGLVCCRGCPAGHYLKAP
CTKPCGAATCLPCPQGTFLAWENHHETRCARCQACDEQAPQVALKNCSAVADTHCGCRPG
WFMECVVSQCLLGSPFRCRRCTDCGALHRHTQEPCSSKDAHCGACLPGFYEHGNSCVSCP
TSTLGSCPEPCVAVCGWRHMFWVQVLLAGLVAPLLLGATLTYTYRRCQPCKAMVPAGEAG
VEALTPLQATQLSPPNSTHTPLVAAGSSEKVCTVQLVGSSWSPGSLQTQELPSPEVTWPW
DQLPSRALGPPSPPSPAPPAGSAASTLQPGPQLYDVMDAVPARRWKEFVRTLGLREAEIE
AVEVEVGRFRDQQYEMLKRWRQQQPAGLAAVYAALERMGLDGCAEDLRSRLQRGP
Download sequence
Identical sequences ENSSSCP00000003659 ENSSSCP00000003665 ENSSSCP00000003659 ENSSSCP00000003665 9823.ENSSSCP00000003659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]