SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003758 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003758
Domain Number 1 Region: 170-437
Classification Level Classification E-value
Superfamily Caspase-like 2.84e-90
Family Caspase catalytic domain 0.000000000439
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily DEATH domain 5.49e-26
Family Caspase recruitment domain, CARD 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003758   Gene: ENSSSCG00000003460   Transcript: ENSSSCT00000003846
Sequence length 438
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:69087122:69111670:-1 gene:ENSSSCG00000003460 transcript:ENSSSCT00000003846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQVLRHCRVRLVRELQVASLWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPVFISCLEDTGQETLASLLRTSRQATKRDLGAIRPLDLHPVVIKPVELKP
EEPSKPPPGKLAPVVLGSKNLWPARPEAPRPVDIGSGGFSDVCGPDRAKGNADLAYVLNA
DPCGHCLIINNVNFCHESGLRKRTGSNIDCERMQRRFHLLHFVVDVKCNLTAKQMVQALV
ELARRDHGALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGG
KPKLFFIQACGGEQKDHGFEVASPSPEDRTADSNPEPDAAPFQEGPGAVDQPDAVSSLPT
PSDILVSYSTFPGFVSWRDTTSGSWYIETLDGVLEQWAHCEDLLTLLLRVSNAVSVKGIY
KQIPGCFNFLRKKLFFKT
Download sequence
Identical sequences F1SUV9
ENSSSCP00000003758 XP_003127666.1.46622 9823.ENSSSCP00000003758 ENSSSCP00000003758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]