SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003763 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003763
Domain Number 1 Region: 216-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000248
Family LIM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 274-343
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000121
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000003763
Domain Number - Region: 185-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00113
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003763   Gene: ENSSSCG00000003465   Transcript: ENSSSCT00000003851
Sequence length 378
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:69340842:69373056:-1 gene:ENSSSCG00000003465 transcript:ENSSSCT00000003851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDEAVVEEVKRAACEARPGCPRESPVPVKAPGAGSAGRL
RSWAPPGRASAPVPAVPPQLSNGGCSLPPPPLDGEDSLPDLDLLPPPPPPPPPMYLPPPD
QEPPASVGALVSDLEQLHLPPPPPPPQALVEGPPLQPQPSPLRPMEELPPPPEEPVSLPE
REASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRVCRRQLAGQSFYQKDGRPLCEPC
YQDTLEKCGKCGEGVREHIIRALGQAFHPTCFTCVTCARCIGDESFALDSQNEVYCLDDF
YRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLN
NRLFCKPCHVKRSAASCC
Download sequence
Identical sequences F1SUU4
ENSSSCP00000003763 ENSSSCP00000003763 XP_003127678.3.46622 XP_005656078.1.46622 XP_013844218.1.46622 XP_020951049.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]