SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003775 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003775
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-55
Family Necap1 N-terminal domain-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003775   Gene: ENSSSCG00000003477   Transcript: ENSSSCT00000003863
Sequence length 280
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:69840051:69856600:1 gene:ENSSSCG00000003477 transcript:ENSSSCT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMEEGGYESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGQVAYIKL
EDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFN
VALQDHFKWVKQQCEFAKQAQNPDQGPKLDLSFKEGQTIKLNIANMKKKEGAAGTPRARP
ASTGGLSLLPPPPGGRTSTLTAHPGEHLSVGGSVIQPAVVPSSGGGSLSEYLGTSIGGAT
VSWPQPKPATAATADIWGDFTKSTGSTSSQPQPGTGWVQF
Download sequence
Identical sequences ENSSSCP00000003775 ENSSSCP00000003775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]