SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003832 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003832
Domain Number 1 Region: 297-691,772-777,808-850
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.4e-98
Family FAD-linked reductases, N-terminal domain 0.000000000000599
Further Details:      
 
Domain Number 2 Region: 676-784
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-30
Family L-aminoacid/polyamine oxidase 0.000000845
Further Details:      
 
Domain Number 3 Region: 192-298
Classification Level Classification E-value
Superfamily Homeodomain-like 1.88e-30
Family SWIRM domain 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003832   Gene: ENSSSCG00000003531   Transcript: ENSSSCT00000003922
Sequence length 873
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:74939243:75075051:1 gene:ENSSSCG00000003531 transcript:ENSSSCT00000003922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGKKAAAAAAAAAAAAAAGSEAGASAAGGAENGSEVTAPPAGLSGPAEAGPGAAGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGQAGGLQ
DDSSGGYGDGQASGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQ
LWLDNPKIQLTFEATVQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTG
KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGG
NPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFN
VLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELH
QQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDV
YLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALA
EGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQF
VPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYK
APILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARG
SYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGL
REAGRIADQFLGAMYTLPRQATPSVPAQQSPSM
Download sequence
Identical sequences A0A287A9K0
ENSSSCP00000003832 ENSSSCP00000003832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]