SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003926 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003926
Domain Number 1 Region: 46-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-37
Family SCAN domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 970-1026
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 886-942
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 748-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 710-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 790-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000331
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 932-963
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000202
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003926   Gene: ENSSSCG00000003621   Transcript: ENSSSCT00000004017
Sequence length 1045
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:83827898:83841870:-1 gene:ENSSSCG00000003621 transcript:ENSSSCT00000004017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVALESQAQASPRSEPEELLIVKLEEDSWRPDSQPQEKDLNPVPGPEASRQRFRQFQYR
DAAGPHEAFSQLWALCCHWLRPEIRLKEQILELLVLEQFLTILPREVQAWVQARHPESGE
EAVALVEDWHREAQAAGQQELELCAEETRSLKTVKESQSFPLQPADHQPEGQSQKQWVKN
PCPDFPKHLDTKMVPQPLKESAVLTPRVPALPKMGSVGDWEVTAESQEALGPGRHAEKEF
CRDPPGDSCGNGVPLGVPVSKPAIISQRDHGPEFWGPGLINSGEKSPADYRDTEQAKPAQ
ALAWRDSKAWEERSRWEVEDVKVSGVHWSYEETKTFLAILSESPFSEKLRTCHQNRQVYR
AIAERLRARGFLRTLEQCRYRVKNLLRNYRKAKSSHPPGTCPFYEELEALVKARAALRAS
GGHGAAVALPRLGDSDMEVDEQEEGGWEPEETAEDCNGDDLTTEESGQGPRIPGGPAMFQ
SRIAGVHWGYEETKAFLTILSESPFSEKLRTCHQNSQVYRAIAERLCAQGFLRTLEQCRY
RFKNLLRSYRKAKSSHPPGTCPFYEELDSLMRARTAVRDVATSKEVAGLPTSGQSSAEAV
NQEAWDEMADEDAIKPPIPSPKILDTGFEMRHEDEDQISEQDIFEDLPGALSTCAAENNC
YPHDWGEDSENENEGKGRWGNPSQEQWEECSSEEDLEKLIDQQGLYLAEKPYKCDMCVKS
FSRNSQLIAHQRTHTGEKPYKCLECGRSFSDRSNFNTHQRIHTGEKPYRCLECGKSFSDH
SNLITHQRTHTRVKPYKCGECWESFTQSSNLLKHQRTHMGGNPDPCREPGGNSSQSPSFP
LHWRTSVQETSPGQPRSASKNVHSPGPPSTNSGERFYECSECGRCFSKSSALISHQRIHT
GQKPYECAECGKSFSKSSTLANHQRTHTGEKPFECADCGKCFGERSKLITHQRVHTGEKP
YKCLECGKFFRDRSNLITHQRIHTGEKPYKCRECGKCFNQSSSLIIHQRIHTGEKPYKCT
ECGKDFNNSSHFSAHRRTHAAGKAS
Download sequence
Identical sequences F1SV80
ENSSSCP00000003926 XP_003127824.1.46622 XP_020951516.1.46622 ENSSSCP00000003926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]