SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003952 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003952
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.82e-21
Family LIM domain 0.0015
Further Details:      
 
Domain Number 2 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.67e-17
Family LIM domain 0.00083
Further Details:      
 
Domain Number 3 Region: 7-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000194
Family LIM domain 0.018
Further Details:      
 
Domain Number 4 Region: 67-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000204
Family LIM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 251-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000266
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003952   Gene: ENSSSCG00000003647   Transcript: ENSSSCT00000004043
Sequence length 280
Comment pep:known chromosome:Sscrofa10.2:6:86858438:86865608:1 gene:ENSSSCG00000003647 transcript:ENSSSCT00000004043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETFDCAKCSESLYGRKYIQTDNGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRH
FHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQ
TWHEHCFLCSGCEQPLGSCSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQP
WHRECLVCTGCQTPLAGQQFTSRDDDPYCVACFGELFAPKCSSCKRPITGLGGGKYVSFE
DRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Download sequence
Identical sequences F1SV39
ENSSSCP00000003949 ENSSSCP00000003952 9823.ENSSSCP00000003949 9823.ENSSSCP00000003952 ENSSSCP00000003949 ENSSSCP00000003952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]