SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004009 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004009
Domain Number 1 Region: 434-493
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.05e-17
Family Erythroid transcription factor GATA-1 0.00051
Further Details:      
 
Domain Number 2 Region: 381-430
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000618
Family Erythroid transcription factor GATA-1 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004009   Gene: ENSSSCG00000003702   Transcript: ENSSSCT00000004101
Sequence length 592
Comment pep:known chromosome:Sscrofa10.2:6:99760293:99790611:1 gene:ENSSSCG00000003702 transcript:ENSSSCT00000004101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTDGGWCLPKRLGAAAADAGDSGGFPAREPSTPPSPISSSSSCCSRGGERGPGGASNC
RTPQLDTEAAAGPTARSLLLNPYASHPFGAPHGPSAPGISAPGGALSSWEDLLLFTDLDQ
AATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAA
AAASSPVYVPTTRVGSMLPGLPYLQGAGSGPANHAGGAGSHPGWPQASADSPPYGSGGGT
AGGGAAGPGSAGSAAAHVSARFPYSPSPPMANGAARDPGGYAAAGGGGAGGVSGGSGGGL
AAMGSREHQYSSLSAARPLNGTYHHHHHHHPSAYSPYVGAPLTPAWPAGPFETPVLHSLQ
SRAGAPLPVPRGPSADLLEDLPESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGL
SRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAM
KKEGIQTRKRKPKNINKSKACSGNSNNSVPMTPTSTSSNSDDCSKNTSPTTQTPASGAGA
SVMSGTGESANPENSELKYSGQDGLYIGVSLASPAEVTSSVRQDSWCALALA
Download sequence
Identical sequences F1SBC0
XP_005656169.1.46622 XP_005656170.1.46622 XP_005656171.1.46622 ENSSSCP00000004009 ENSSSCP00000004009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]