SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004048 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004048
Domain Number 1 Region: 42-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-37
Family SCAN domain 0.0000967
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 4 Region: 437-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 283-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004048   Gene: ENSSSCG00000003740   Transcript: ENSSSCT00000004141
Sequence length 492
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:111424794:111431186:1 gene:ENSSSCG00000003740 transcript:ENSSSCT00000004141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKSGALAYHTPKEQEGLIIVKVEEENYVWGQDLGLPGNACSQDAFRQRFRQFGYSDSA
GPREALSRLRELCCLWLRPEVHSKEQILELLVLEQFLAILPEELQTWLLENRPESGEEAV
VMLEELEKELDEPRQQDTAHAQGMMWKEMTSVGALKSLSVQLQPLENQHKSETQEPQAFS
ERDGNLVADKVLKAKQDIIECGSSAAMMAPGQRPGETPSGQTVGEALGGLDDFDKPKGSA
AGNKVSQLPFQERHFSLPSFNKNVFTEEHVLEHDGNERSLSLNSNIIVQPRIHTGGKLYQ
CFDCGKAFCQSSKLIRHQRIHTGERPYTCKECGKAFSLSSDLVRHQRIHSGEKPYECCEC
GKAFRGSSELVRHRRIHTGEKPYECGECGRAFSRSSALIQHKKIHTGDKGYECIECGKAF
GRSSILIEHQRIHTGEKPYECNECGKSFNQSSALTQHQRIHTGEKPYECSECRKTFRHRS
GLMQHQRTHTRV
Download sequence
Identical sequences ENSSSCP00000004048 ENSSSCP00000004048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]