SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004303 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004303
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 70-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.78e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004303
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0549
Family SCAN domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004303   Gene: ENSSSCG00000003982   Transcript: ENSSSCT00000004404
Sequence length 534
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:157645866:157659807:-1 gene:ENSSSCG00000003982 transcript:ENSSSCT00000004404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQRLLISLPAETSSWVKLHHPEKAPEGAPLWEDVPEMSEGEALLSRGADETQGESFEEE
ATSGSLAEESQEQLTFRDVSVDFTQEEWGQLAPAHRHLYREVMLENYGNLVSVGYQLSKP
GVISQLEKGEEPWLMEREVSGGPSPDLKGETETKESALKNELSWKELHHCLMMEKSTRGS
TLTSTLGRVSQCHKLENHQEKQGMSEGQMLLIHKKTPTQERGQESNRFEKSGNMNSKVIP
GPVGPPRKRHHKYDVSGKKSRYNLDLINHSRGCTRMKTFECNICEKIFKQFIHLTEHMRI
HTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGE
KPYECGICEKAFSQSIGLIQHLRTHVREKPFTCKGCGKAFFQIRHLRQHEIIHTGVKPYV
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHC
GKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRTTFSNGM
Download sequence
Identical sequences ENSSSCP00000004303 9823.ENSSSCP00000004303 ENSSSCP00000004303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]