SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004352 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004352
Domain Number 1 Region: 398-713
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.92e-101
Family PDEase 0.000000606
Further Details:      
 
Domain Number 2 Region: 184-375
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 27-176
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-19
Family GAF domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004352   Gene: ENSSSCG00000004027   Transcript: ENSSSCT00000004453
Sequence length 722
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:4635847:4742048:1 gene:ENSSSCG00000004027 transcript:ENSSSCT00000004453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNS
LCVFTPPGIKEGKPRLIPAGPIAQGTTTSAYVAKSRKTLLVEDILGDERFPRGTGLESGT
RIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVCRGL
AKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDL
FDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYT
TRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHRIRH
SECIYRVTMEKLSYHSICTAEEWQGLMRFNLPVRLCKEIELFHFDIGPFENMWPGIFVYM
VHRSCGTACFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHGLFTDLER
KGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFST
LSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTAC
DLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQQLGFYNA
VAIPCYTTLTQIFPPTEPLLKACRNNLSQWEKVIRGEESAVWISSPPAAQGTSEKLPVKI
DD
Download sequence
Identical sequences ENSSSCP00000004352 ENSSSCP00000004352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]