SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004385 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004385
Domain Number 1 Region: 265-353
Classification Level Classification E-value
Superfamily Moesin tail domain 1.22e-32
Family Moesin tail domain 0.0000249
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-28
Family Third domain of FERM 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004385   Gene: ENSSSCG00000004058   Transcript: ENSSSCT00000004487
Sequence length 353
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:10423018:10432335:1 gene:ENSSSCG00000004058 transcript:ENSSSCT00000004487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYM
RRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQ
DYEEKTRKAERELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIK
SQEQLATELAEYTAKIALLEEARRRKEDEVEEWQLRAKEAQDDLVKTKEELHLVMTAPPP
PPPVYEPVSLHVQESPPEESPEYTGYSAELCSEGILDDRNEEKRITEAEKNERVQRQLMT
LTNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences 9823.ENSSSCP00000004385 ENSSSCP00000004385 ENSSSCP00000004385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]