SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004434 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004434
Domain Number 1 Region: 309-346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 208-298
Classification Level Classification E-value
Superfamily PKD domain 0.00000000863
Family PKD domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004434   Gene: ENSSSCG00000004101   Transcript: ENSSSCT00000004536
Sequence length 498
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:18476457:18536993:-1 gene:ENSSSCG00000004101 transcript:ENSSSCT00000004536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASATRESTGSGRKRPPRRPALHGLLLLCLWLPSGRAAASPSAPLSELHAQLSGVEQLLE
EFRRQLQQERPQEELELELRAGGGPQEGCPGPGGGGYSAMPDAIIRTKDSIAAGASFLRA
PAAVRDWRQCLAACCLEPRCSVAVVELSRRPASPAAALGCYLFNCTARGRNVCKFALHRG
YSSYSLSRGSEAGAPATARASARLEKDEPPLSKAGQDVVLHLPTDGVILDGRESTDDRAI
VQYEWTLLQGDPSVDMKVPQSGTLKLSHLQEGTYTFQLTVMDTAGQRSSDNVSVTVLPQA
FSTGGCSKVCSRYHFFCDDGCCIDITLACDGVEQCPDGSDEVFCQNLKLDRKMVTHTATA
QPRTTEPSQDAGGGSLLEKSQKATAPQQPPVLSTTEKRNHSAFREPESHIVPGLPESGAS
GKTRKEENYIFESKSNRGGGEHPAPEAGAVLPLALGLAITALLLLMVACRLRLVKQKLKK
ARPITSEESDYLINGMYL
Download sequence
Identical sequences 9823.ENSSSCP00000004434 ENSSSCP00000004434 ENSSSCP00000004434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]