SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004504 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004504
Domain Number 1 Region: 260-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-63
Family G proteins 0.000000969
Further Details:      
 
Domain Number 2 Region: 580-684
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.17e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00041
Further Details:      
 
Domain Number 3 Region: 53-129
Classification Level Classification E-value
Superfamily HBS1-like domain 2.62e-27
Family HBS1-like domain 0.0000282
Further Details:      
 
Domain Number 4 Region: 481-576
Classification Level Classification E-value
Superfamily Translation proteins 3.14e-24
Family Elongation factors 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004504   Gene: ENSSSCG00000004169   Transcript: ENSSSCT00000004608
Sequence length 686
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:32459602:32540970:1 gene:ENSSSCG00000004169 transcript:ENSSSCT00000004608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVVEPVEEYDYE
DLKESSNSLLDHQLSGIDQARLYSCLDHMREVLGDAVPDDILIEAVLKNKFDVQKALSVV
LEKDKIQNLKVKHEAAIPTGKIAKGKSIDSQSPRSESDVVPKVAKMTVSGKKQTMGFEVP
GVTAEENGHNFHTPQKGHSSEDNTVISSDVLETVSKSALPSHTIQASEEQSSTPTPVKKS
SKLRQQIDIKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHLLYLLGNVNKRTMHKYEQE
SKKAGKASFAYAWVLDETGEERENGVSKDVGMTKFETTTKVITLMDAPGHKDFIPNMITG
AAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERF
QEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLITRSKSSELTKWYKGLCLLEQIDSFK
PPQRSVDKPFRLCVSDVFKDQGSGFCVTGKIEAGYVQTGDRLLAMPPNETCTAKGITLHD
EPVDWAAAGDHVSLTLVGMDIIKINVGCIFCGPKEPIKACTRFRARILIFNIEIPITKGF
PVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKLLTKGQNALVELQTQRPVALELYKD
FKELGRFMLRYSGSTIAAGVVTELKE
Download sequence
Identical sequences ENSSSCP00000004504 ENSSSCP00000004504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]