SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004732 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004732
Domain Number 1 Region: 120-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-60
Family Nuclear receptor ligand-binding domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 49-135
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004732   Gene: ENSSSCG00000004384   Transcript: ENSSSCT00000004846
Sequence length 421
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:83543258:83562994:1 gene:ENSSSCG00000004384 transcript:ENSSSCT00000004846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRTRAEGEEEESSRWLIRDDPGGGLAFPVSLGPIWSLLLESLESRILDIPCKVCGDRSS
GKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRACRLKKCLEVNMN
KDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLEL
AAVSATPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVP
AFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISE
IQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLT
LNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSD
I
Download sequence
Identical sequences ENSSSCP00000004732 ENSSSCP00000027620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]