SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004841 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004841
Domain Number 1 Region: 36-96,127-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004841   Gene: ENSSSCG00000004487   Transcript: ENSSSCT00000004958
Sequence length 691
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:103500011:103525341:-1 gene:ENSSSCG00000004487 transcript:ENSSSCT00000004958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLRGCGRRVAAFLIKQHLPSAGFSGDGAAPRTPHFDVVVIGGGHAGTEAAAAAARCGS
RTLLLTHRVDTIGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGP
AVWGLRAQIDRNLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPERTGKYRVCGVVLVD
GNTVYADSVVLTTGTFLRGVIVIGLETHPAGRLGDQPSVGLAQTLEKLGFVVGRLKTGTP
PRIAKESINFSILNKQTPDNPSIPFSFMNETVWIKPEDQLPCHLTHTNPRVDEIVLENLH
LNCHVKETTRGPRYCPSIESKVLRFPNRLHQVWLEPEGMDSDLIYPQGLSVTLPAELQEK
MITCIRGLEKAKMIQPGYGVQYDYLDPRQITPSLETHLVQRLFFAGQINGTTGYEEAAAQ
GIMAGINASLRVRCKPPFVISRTEGYIGVLIDDLTTLGTNEPYRMFTSRAEFRLSLRPDN
ADNRLTFRGYKEAGCVSQQRYERASWMKSSLEEGISVLKSIEFSSSKWKNLIPEASISIG
KSVPLRALDVLKYEEVDMKSLAKAVPEPLKKYSKCRELAERLKIEATYEAVLFHQQQEMK
EVQRDEALRLPEDLDYLTLRDVSLSYEVREKLHFSRPQTIGAASRIPGVTPAAIINLLRF
VKTTQQRQAAMNRSPQTDQHLCDTDKLERQL
Download sequence
Identical sequences F1RQG8
9823.ENSSSCP00000004841 ENSSSCP00000004841 XP_003121457.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]