SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004900 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004900
Domain Number 1 Region: 9-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.08e-81
Family Ankyrin repeat 0.0000127
Further Details:      
 
Domain Number 2 Region: 372-465
Classification Level Classification E-value
Superfamily DEATH domain 2.49e-17
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004900   Gene: ENSSSCG00000004545   Transcript: ENSSSCT00000005020
Sequence length 479
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:117811684:117851512:1 gene:ENSSSCG00000004545 transcript:ENSSSCT00000005020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLPLERQLHEAARRNHVRRIMELIGRRVNLRARNHVGRVALHWAAGAGHEQAVRLLLEH
EAAVDDEDAFGMNALLLSAWFGHLQILQILVNSGAKIHCENKDGLTLLHCAALKGHVPVL
AFIMEDLEDVALDHADKLGRTAFHRAVEHGQLGALDFLVGSGCDHSVKDKEGNTALHLAA
GRGHLAVLQRLVDIGLDLEEQNVEGLTALHAAAEGIHPDCVQLLLGAGSSVNALTQKKQS
CLHYAVLGGSEDMVRALIHAGASTSVADHQGASPVHLAVRHNFPILVQLLIDAGSDLDAT
DNRQQTPLHLAAEHARQDIAEMLLVAGVDLNLRDKQGKTALAVAARSNHINLVDMIIKAD
RFYRWEKDHRQEMQQLRSVLWRLASRYLRPHEWKKLAYHWEFTEAHVYAMEQQWTGTKSY
QEHGHRMLLIWLHGVIMAGENSSKALFEGLVAIGRRDLAESIRKKASDDLSAPRRCTAM
Download sequence
Identical sequences ENSSSCP00000004900 ENSSSCP00000004900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]