SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005024 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005024
Domain Number 1 Region: 167-224
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.53e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 107-164
Classification Level Classification E-value
Superfamily Translation proteins 0.00000707
Family Elongation factors 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005024   Gene: ENSSSCG00000004664   Transcript: ENSSSCT00000005150
Sequence length 225
Comment pep:novel chromosome:Sscrofa10.2:1:139609651:139610354:1 gene:ENSSSCG00000004664 transcript:ENSSSCT00000005150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDSTEILLNHRDNNEVSTYFKKMGYNPNVEFVQISHWNERNMLEPSANMPWFTVLKITGK
ETKLLKSLDYILPPILTDRSLDVYKIGDYWYCSWGLSGDWCCQTCLVVAFAPVNTTTGVN
PVQIHYEVLNEALLGENVDFGVKNVSVKDVHHGVEAGDSENDPPREAAGFTDQVITLNHP
GQISAGYKPVLDCHATHIVCKFAELRKKVDHHSGKELKKWPKILE
Download sequence
Identical sequences ENSSSCP00000005024 ENSSSCP00000005024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]