SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005290 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005290
Domain Number 1 Region: 250-480
Classification Level Classification E-value
Superfamily Caspase-like 2.69e-38
Family Caspase catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 140-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000601
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 39-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000194
Family I set domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005290   Gene: ENSSSCG00000004917   Transcript: ENSSSCT00000005425
Sequence length 742
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:179658938:179701160:1 gene:ENSSSCG00000004917 transcript:ENSSSCT00000005425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFCSLGLVGHRGKSFNDLFSFLLESQPTHVYGLKKQKGIKITVNPESKAVLAGEFVKLCC
RATGHPFVQYQWFKMNKEIPNGNASELIFNTVHVKDAGFYVCRVNNNFTFEFSQWSQLDV
CDVTEVTESFRRSIDGISESKLQICVEPRSQKLMPGSTLVLECVAVGSPIPHYQWFKNES
PLTHETKKLYMVPYVDLEHQGTYWCRVYNDRDSQDSKKVEVIIEQGRTDEAVECTEDELN
NLGHPDNKEQTAEQPLAKDKVALLIGNMNYWEHPKLKAPLVDVYELTNLLRQLDFKVVSL
LDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPIDAPNPYRSENCLCVQ
NILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQH
SGLANGIFMKFLKDRLLEEKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDP
IQGTAHSAESLVRNLQWAKAHELPESMCLKFHCGVQIQLGFAAEFSNVMIIYTSIVHKPP
DILMCDAYVTDFPLDLDIDPKDANKETPEETGSYLVSKELPKHCLYTRLSSLQKLKEHLV
FTVCLSYQYSGLEDTIEEKQEVNVGKPLIAKLDIHRGLGRKTSFQTCIMCNGPYQSSAST
SAGAAHYHSSQDSFCGVYHSHLSNSSNAMPSDSCQCSRTADAFISSHHTHHYSCQFGRSN
VPVETTDEIPFSFSDGLRISEK
Download sequence
Identical sequences ENSSSCP00000005290 ENSSSCP00000005290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]