SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000005355

Domain assignment for ENSSSCP00000005355 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000005355
Domain Number 1	Region: 411-468
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000288
Family	TSP-1 type 1 repeat	0.0048
Further Details:

Domain Number 2	Region: 235-292
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000124
Family	TSP-1 type 1 repeat	0.0053
Further Details:

Domain Number 3	Region: 293-349
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000131
Family	TSP-1 type 1 repeat	0.0043
Further Details:

Domain Number 4	Region: 472-523
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000523
Family	TSP-1 type 1 repeat	0.0043
Further Details:

Domain Number 5	Region: 353-406
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000889
Family	TSP-1 type 1 repeat	0.0055
Further Details:

Domain Number 6	Region: 182-232
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.00000111
Family	TSP-1 type 1 repeat	0.0089
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000005355 Gene: ENSSSCG00000004980 Transcript: ENSSSCT00000005492
Sequence length	576
Comment	pep:known_by_projection chromosome:Sscrofa10.2:1:187774212:188055229:1 gene:ENSSSCG00000004980 transcript:ENSSSCT00000005492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEISSTAGESFLAEGPT NEILDVYMIHQQPNPGVHYEYVIMGNNAISPQVPPHRRPGEPFNGQLGPEGRSQEEGEEK EGDEPKADTHGGAPEIFTSESAQTFPVRHPDRFSSHRPDNVVPPAPQPPRRSRDHNWKQL GTTECSTTCGKGSQYPIFRCVHRSTHEEVPESYCDSSMKPTPEEEPCNIFPCPAFWDIGE WSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTD WTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSE RCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQC SVECGSGTQQREVICVRKNADTFEVLDPYECSFLERPPSQQSCHLKPCGAKWFNTEWSMC SKSCQGGFRVREVRCLSDDMTLSNLCDPQLKPEEKESCNPQDCVPEVAPDENCKDRYYNC NVVVQARLCVYNYYKTACCVSCTRVASRHSGFLGSR
Download sequence
Identical sequences	ENSSSCP00000005355 ENSSSCP00000005355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]