SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005356 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005356
Domain Number 1 Region: 203-260
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000589
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 261-317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000497
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005356
Domain Number - Region: 321-346
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000235
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005356   Gene: ENSSSCG00000004980   Transcript: ENSSSCT00000005493
Sequence length 346
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:187774212:188055229:1 gene:ENSSSCG00000004980 transcript:ENSSSCT00000005493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGTMFTYKRPNEISSTAGESFLAEGPT
NEILDVYMIHQQPNPGVHYEYVIMGNNAISPQVPPHRRPVLFRASPPLLPPTFPVRHPDR
FSSHRPDNVVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEVPES
YCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQP
YRCQHLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEEC
NMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCM
Download sequence
Identical sequences ENSSSCP00000005356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]